PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G0392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 467aa    MW: 52311.2 Da    PI: 8.2048
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G0392genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-17154200148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed +l+++vkq+G + W+ Ia+ +  gR +kqc++rw+++l
      Gh_D10G0392 154 KGQWTDDEDRKLIRLVKQYGVRKWAQIAESLV-GRAGKQCRERWHNHL 200
                      799*****************************.*************97 PP

2Myb_DNA-binding54.62.5e-17206248145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+ +l++a+++ G++ W+ Ia+ ++ gRt++ +k++w+
      Gh_D10G0392 206 KDSWSEEEERILIEAHAKVGNR-WAEIAKFIP-GRTENAIKNHWN 248
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.107149204IPR017930Myb domain
SuperFamilySSF466891.22E-30152247IPR009057Homeodomain-like
SMARTSM007172.0E-16153202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-27155208IPR009057Homeodomain-like
PfamPF139211.3E-19157214No hitNo description
CDDcd001671.31E-15157200No hitNo description
SMARTSM007179.1E-18205253IPR001005SANT/Myb domain
PROSITE profilePS5129421.601205255IPR017930Myb domain
CDDcd001671.85E-14208251No hitNo description
Gene3DG3DSA:1.10.10.602.7E-21209253IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MEEVRGRRVA FGYGNLLCNN NCKPSPCKSS PPLSAIDRFL WGQTQSLSSH SQAAHQPPYP  60
VQNNVKINKG TVLGSTADAL LRGFSFPSDA IGGYLPRQTN LEESFLDGLF VDGEILALTE  120
DKNPNTEMKA SMKGDFPKGV LKRNKKVASA ALIKGQWTDD EDRKLIRLVK QYGVRKWAQI  180
AESLVGRAGK QCRERWHNHL RPDIKKDSWS EEEERILIEA HAKVGNRWAE IAKFIPGRTE  240
NAIKNHWNAT KRRQNSRKKN KQNDNQNGKP QSSILQDYIR SQNLNTPTNS STTSATPSSS  300
TFSEDLSTQF NYFLPEPSES DDSHPLVVQT YVDELMFMQN FFANNNNTIH PSLDYSQTGN  360
PTEVFKSVHV VDHNLSKSSS TIDCPTFADT RFGFSSSIQE PKTEPRTTYL FSDLYLSRLL  420
NGATTSSFPN GDGYYNGDVN TNLLSGQASS DGRKEMDLIE MVSSSQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-471522542104C-Myb DNA-Binding Domain
1msf_C1e-471522542104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454623.10.0PREDICTED: transcription factor MYB44-like isoform X1
TrEMBLA0A0D2T2910.0A0A0D2T291_G
STRINGPOPTR_0009s04870.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.16e-64myb domain protein 119